DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B8 and Y63D3A.7

DIOPT Version :9

Sequence 1:NP_652341.1 Gene:ND-B8 / 50178 FlyBaseID:FBgn0040705 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_493465.2 Gene:Y63D3A.7 / 173279 WormBaseID:WBGene00013406 Length:92 Species:Caenorhabditis elegans


Alignment Length:67 Identity:32/67 - (47%)
Similarity:44/67 - (65%) Gaps:2/67 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RLASFTPKLKELRIILDPKGDTSKGVREYVERFYPNLKKSNPDLPILVRECSGVQPRLYARYGNG 71
            |||.  ..|:|:||.:..|...|.|||.::|..|..:||:||..|||:||.||:.||::|||.:|
 Worm     4 RLAG--TALREIRIHVCQKSPASAGVRAFIENDYVGIKKANPQFPILIREASGIVPRVFARYEHG 66

  Fly    72 KE 73
            .|
 Worm    67 VE 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B8NP_652341.1 L51_S25_CI-B8 29..93 CDD:197984 24/45 (53%)
Y63D3A.7NP_493465.2 L51_S25_CI-B8 22..91 CDD:197984 24/47 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159409
Domainoid 1 1.000 53 1.000 Domainoid score I7628
eggNOG 1 0.900 - - E1_KOG3446
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I3974
Isobase 1 0.950 - 0 Normalized mean entropy S3381
OMA 1 1.010 - - QHG54875
OrthoDB 1 1.010 - - D1633416at2759
OrthoFinder 1 1.000 - - FOG0003685
OrthoInspector 1 1.000 - - oto19628
orthoMCL 1 0.900 - - OOG6_103777
Panther 1 1.100 - - LDO PTHR12878
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4437
SonicParanoid 1 1.000 - - X2554
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.750

Return to query results.
Submit another query.