DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Teh3 and Teh1

DIOPT Version :9

Sequence 1:NP_652335.1 Gene:Teh3 / 50170 FlyBaseID:FBgn0040697 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001262442.1 Gene:Teh1 / 41215 FlyBaseID:FBgn0037766 Length:299 Species:Drosophila melanogaster


Alignment Length:267 Identity:58/267 - (21%)
Similarity:94/267 - (35%) Gaps:103/267 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 FNCTAGQC------LNITDAFECIFHN-SDAPVKCSGRRGKINCMDISGLYSCSRGTCRKIRTPY 201
            |:.|||..      |.:..|...:.|: .:.|..|:..|.:    |:.|:::||..:||:     
  Fly    54 FSVTAGASLLFLVPLYVDPAISTLSHDFIEKPTLCTTTRRE----DLVGIFNCSWSSCRE----- 109

  Fly   202 NCDR---RCVDIPTRNKNVVVLSGDKVYLSQCQNAINAETLEEVWNESSENVAMTSCYFIRHTSD 263
            .|..   |||.|               |::..:..|                             
  Fly   110 GCTSDLYRCVHI---------------YVTFIEQNI----------------------------- 130

  Fly   264 QVDAVDCINGSTLETNMLSDLTNFTYLSHLHVSVATPVPEIAPPDVDLTISNESKLMINLEGCVN 328
                       |:..|| :|.:|||                    .|:..|.|:.|::|::||..
  Fly   131 -----------TIPENM-TDYSNFT--------------------SDMEQSGEATLLVNIKGCGY 163

  Fly   329 TLMDECKEFLKDFGRDGSDHNARARFPCFYSPGKKDVVVARFDLEVTYRQFVFASVVPSVLFVVS 393
            .....||.|...:|.:|      |.||||||...|.||:..::.:......:....||.|:.|:|
  Fly   164 PPSVTCKNFNGYYGIEG------AIFPCFYSRKNKTVVLTSYNHDDQVAMIIHFFAVPFVITVIS 222

  Fly   394 CSILIMC 400
            .  :.:|
  Fly   223 S--IALC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Teh3NP_652335.1 None
Teh1NP_001262442.1 TipE 37..>221 CDD:293577 55/257 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469575
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12335
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.