DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Teh3 and Teh2

DIOPT Version :9

Sequence 1:NP_652335.1 Gene:Teh3 / 50170 FlyBaseID:FBgn0040697 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001163345.1 Gene:Teh2 / 38502 FlyBaseID:FBgn0035505 Length:313 Species:Drosophila melanogaster


Alignment Length:271 Identity:60/271 - (22%)
Similarity:97/271 - (35%) Gaps:81/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 KCSGRRGKINCMDISGLYSCSRGTCRKIRTPYNCDRRCVD-IPTRNKNV---VVLSGDKVYLSQC 230
            :| |..|. .|...||   ..|..|   ::|......||| |..:.:.:   .:|...|.|.|.|
  Fly    35 RC-GSAGS-GCGSASG---SMRSAC---QSPVRPGSGCVDAIKAKREEIEMDTLLEKAKFYTSVC 91

  Fly   231 QNA--------------------------------INAETLEEVWNESSENVAMTSCYFIRHTSD 263
            ...                                :....::.::.|..:|.:.:||.       
  Fly    92 LGTTAILSVFTFLFLIPFVVDPAISTIIADYDPVPVTCIVIDHIYAEGIKNCSWSSCR------- 149

  Fly   264 QVDAVDCINGSTLETNMLSDLTNFTYLSHLHVSVATPVP----EIAPPDVDLTIS---NESKLMI 321
                    .|.|         ::.|....|.|:. |.:|    |..|.|:| |::   :.:|.:|
  Fly   150 --------EGCT---------SSLTKCHQLFVNY-TRIPFSEWERNPRDLD-TVNWDVSYTKFLI 195

  Fly   322 NLEGCVNTLMDECKEFLKDFGRDGSDHNARARFPCFYSPGKKDVVVARFDLEVTYRQFVFASVVP 386
            |.|||.......|..|.:.:   |..|.... ||||||....:||:.|:..|......:.:.::|
  Fly   196 NSEGCGYPPTTNCSIFARQY---GFSHIGEP-FPCFYSRAYPEVVIGRYSWENNLYHLILSLIIP 256

  Fly   387 SVLFVVSCSIL 397
            :|||.:|..:|
  Fly   257 NVLFAISIGVL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Teh3NP_652335.1 None
Teh2NP_001163345.1 TipE 73..>271 CDD:293577 47/225 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469577
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12335
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.