| Sequence 1: | NP_004552.2 | Gene: | OVOL1 / 5017 | HGNCID: | 8525 | Length: | 267 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650861.1 | Gene: | trem / 42392 | FlyBaseID: | FBgn0038767 | Length: | 439 | Species: | Drosophila melanogaster |
| Alignment Length: | 251 | Identity: | 74/251 - (29%) |
|---|---|---|---|
| Similarity: | 92/251 - (36%) | Gaps: | 67/251 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Human 22 LPDE-ERGEIYVPVSLGFCPPQPYREPE-------PSVA-------------EPPSCPLALNMSL 65
Human 66 RDSSYS---MAPGPC------VVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFT-- 119
Human 120 CRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFT 184
Human 185 QRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSP 240 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| OVOL1 | NP_004552.2 | C2H2 Zn finger | 120..140 | CDD:275368 | 8/19 (42%) |
| C2H2 Zn finger | 148..168 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 160..185 | CDD:316026 | 15/24 (63%) | ||
| C2H2 Zn finger | 176..197 | CDD:275368 | 6/20 (30%) | ||
| trem | NP_650861.1 | zf-AD | 11..87 | CDD:214871 | |
| COG5048 | <264..411 | CDD:227381 | 50/131 (38%) | ||
| C2H2 Zn finger | 274..294 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 287..311 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 302..322 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 315..338 | CDD:290200 | 14/22 (64%) | ||
| C2H2 Zn finger | 330..350 | CDD:275368 | 6/20 (30%) | ||
| zf-H2C2_2 | 345..367 | CDD:290200 | 11/32 (34%) | ||
| C2H2 Zn finger | 358..378 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 370..394 | CDD:290200 | 3/14 (21%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||