DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14645 and CG3348

DIOPT Version :9

Sequence 1:NP_652325.2 Gene:CG14645 / 50160 FlyBaseID:FBgn0040687 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001303428.1 Gene:CG3348 / 50082 FlyBaseID:FBgn0040609 Length:98 Species:Drosophila melanogaster


Alignment Length:75 Identity:25/75 - (33%)
Similarity:41/75 - (54%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YDGDGQPGCKTQAELDIVVFRNNWDATSYWKCETLNKPAIEIKCPSETGFMDSLKNCVNWEEWEW 85
            ::.:|:|.|:...|:: .:|||.||.|:||.|:.....|...:||....:.:.|..||::.:|.|
  Fly    16 HEHNGEPSCQGLDEVN-RMFRNYWDPTAYWVCDKQGTRARLQRCPQSQLYSEELGRCVHYADWAW 79

  Fly    86 EKPVEPLSEA 95
            ..|.||...|
  Fly    80 TDPKEPAGRA 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14645NP_652325.2 None
CG3348NP_001303428.1 ChtBD2 24..73 CDD:214696 16/49 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449182
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F5S7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26159
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20987
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.