DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14645 and CG34282

DIOPT Version :10

Sequence 1:NP_652325.2 Gene:CG14645 / 50160 FlyBaseID:FBgn0040687 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001097830.1 Gene:CG34282 / 42248 FlyBaseID:FBgn0085311 Length:94 Species:Drosophila melanogaster


Alignment Length:90 Identity:32/90 - (35%)
Similarity:45/90 - (50%) Gaps:4/90 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVQLALTSLLVISFGIALAYDGD---GQPGCKTQAELDIVVFRNNWDATSYWKCETLNKPAIEIK 63
            ||.:....||.:...::.||:|.   .:|.|.. .|.....||:..|.|.||.|....:.|..|:
  Fly     3 KVSIICCLLLGLFLALSSAYNGQDIYAEPNCAI-VEDHARKFRDISDPTHYWVCPEGQEKADYIQ 66

  Fly    64 CPSETGFMDSLKNCVNWEEWEWEKP 88
            ||....||:..:|||.||||:|.:|
  Fly    67 CPDNYAFMEQQQNCVVWEEWKWVEP 91

Return to query results.
Submit another query.