DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OTX2 and OdsH

DIOPT Version :10

Sequence 1:NP_068374.1 Gene:OTX2 / 5015 HGNCID:8522 Length:297 Species:Homo sapiens
Sequence 2:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster


Alignment Length:150 Identity:50/150 - (33%)
Similarity:67/150 - (44%) Gaps:28/150 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     5 LKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTR 69
            :||.|.:..|........|....|                |:||.||.|...||..||.:|..:.
  Fly   133 IKQDPLSDEGADSNLGQNDCTESS----------------KKRRGRTNFNSWQLRELERVFQGSH 181

Human    70 YPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESG 134
            ||||||||.:|.|::|.|.|:.|||:|||||.|:|:..::..|:           ||.....:| 
  Fly   182 YPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQEHTKKGPGR-----------PAHNAHPQS- 234

Human   135 TSGQFTPPSSTSVPTIASSS 154
            .||...|.|......:|..|
  Fly   235 CSGDPIPLSELRARELAQRS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OTX2NP_068374.1 Homeodomain 47..102 CDD:459649 31/54 (57%)
TF_Otx 161..242 CDD:427350
OdsHNP_523389.3 Homeodomain 159..215 CDD:459649 31/55 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.