DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OTX2 and unc-4

DIOPT Version :10

Sequence 1:NP_068374.1 Gene:OTX2 / 5015 HGNCID:8522 Length:297 Species:Homo sapiens
Sequence 2:NP_573242.2 Gene:unc-4 / 32757 FlyBaseID:FBgn0024184 Length:588 Species:Drosophila melanogaster


Alignment Length:114 Identity:45/114 - (39%)
Similarity:67/114 - (58%) Gaps:14/114 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    30 GYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWF 94
            |:||......:|.  |:||.||.|...||:.||..|:.:.||||||||.:|::::|.||||.|||
  Fly   229 GFPGDGDDDSSAA--KRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWF 291

Human    95 KNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPS 143
            :|||||.|:::..::..|:           ||.....:: .||:..||:
  Fly   292 QNRRAKVRKREHTKKGPGR-----------PAHNAQPQT-CSGEPIPPN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OTX2NP_068374.1 Homeodomain 47..102 CDD:459649 32/54 (59%)
TF_Otx 161..242 CDD:427350
unc-4NP_573242.2 Homeodomain 244..300 CDD:459649 32/55 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.