DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and DIRAS3

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_004666.1 Gene:DIRAS3 / 9077 HGNCID:687 Length:229 Species:Homo sapiens


Alignment Length:169 Identity:60/169 - (35%)
Similarity:93/169 - (55%) Gaps:9/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDT-SGDMQFPAMR 71
            |:|::|.||||||:::.::....:..:|..|:|:.|.:........|.:.|.|: |||.. .|::
Human    39 RVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGN-RALQ 102

  Fly    72 RLSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRG-DFQDIPIVIAGNKADLATTHREVKLEE 135
            |..||..|||:|||:.|...:.:.:|..:|.|.:.:| :....|||:.|||:|  .|||||.|  
Human   103 RHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSD--DTHREVAL-- 163

  Fly   136 VTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSR 174
             .|...|.: ......:|.|||.|.||.:||..||:..:
Human   164 -NDGATCAM-EWNCAFMEISAKTDVNVQELFHMLLNYKK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 60/165 (36%)
Ras 8..170 CDD:278499 58/163 (36%)
DIRAS3NP_004666.1 P-loop_NTPase 37..200 CDD:328724 60/167 (36%)
Effector region. /evidence=ECO:0000255 66..74 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.