DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and rasd1

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001072408.1 Gene:rasd1 / 779862 XenbaseID:XB-GENE-483475 Length:266 Species:Xenopus tropicalis


Alignment Length:256 Identity:86/256 - (33%)
Similarity:132/256 - (51%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRR 72
            |:|:||.:.|||:|||.|||...:.::|..|:||.:.:.|.:.|...::|||||||:..||||||
 Frog    21 RMVILGSSKVGKTSIVSRFLSGRFEEQYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRR 85

  Fly    73 LSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQ-------DIPIVIAGNKADLATTHRE 130
            |||.|...|:||::..:..||:.|::..::|.|.:...:       |:||||.|||.| ...:||
 Frog    86 LSILTGDVFILVFSLDNRDSFEEVQRLKQQIIETKSCLKNKTKENVDVPIVICGNKVD-RDFYRE 149

  Fly   131 VKLEEVTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRFLPASSS-------------- 181
            |:..|:...|..:   .:....|.|||::|::.::||:|.:::: ||:..|              
 Frog   150 VQPHEIEQLVGED---SKCSYFEVSAKKNSSLDEMFKALFTMAK-LPSEMSPDLHRKVSVQYCEI 210

  Fly   182 -------GSGGSGGG---GEAAPSGFKRRSSAYVSASSSRNKNRMNSPALGGAGGSGGDKK 232
                   |......|   |..||  |.||.|.:......|.|      |:|  ||...||:
 Frog   211 LHKKSLKGKKVKEDGDAYGIVAP--FARRPSIHSDLMYIRAK------AVG--GGQSKDKE 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 66/170 (39%)
Ras 8..170 CDD:278499 65/168 (39%)
rasd1NP_001072408.1 Rhes_like 20..266 CDD:133343 86/256 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.