DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and Rasd2

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_083458.1 Gene:Rasd2 / 75141 MGIID:1922391 Length:266 Species:Mus musculus


Alignment Length:192 Identity:73/192 - (38%)
Similarity:111/192 - (57%) Gaps:33/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRR 72
            |:|:||.:.|||||||.|||...:.|:|..|:||.:.:.|::.|...::|||||||:..||||||
Mouse    21 RMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIHGDMYQLDILDTSGNHPFPAMRR 85

  Fly    73 LSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRG-------DFQDIPIVIAGNKADLATTHRE 130
            |||.|...|:||::..|..||..||:..::|.|.:.       :..::|:||.|||.|    |.|
Mouse    86 LSILTGDVFILVFSLDSRESFDEVKRLQKQILEVKSCLKNKTKEAAELPMVICGNKND----HSE 146

  Fly   131 VKLEEVTDWVFC-ELPRLRAKVL----------ECSAKEDSNVTDLFKSLLSLSRFLPASSS 181
            :          | ::|.:.|::|          |.|||:::||.::|..|.|::: ||...|
Mouse   147 L----------CRQVPAMEAELLVSGDENCAYFEVSAKKNTNVNEMFYVLFSMAK-LPHEMS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 69/181 (38%)
Ras 8..170 CDD:278499 68/179 (38%)
Rasd2NP_083458.1 Rhes_like 20..266 CDD:133343 73/192 (38%)
Effector region 48..56 4/7 (57%)
Interaction with GNB1, GNB2 and GNB3. /evidence=ECO:0000250 189..235 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.