DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and Rap2c

DIOPT Version :10

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_766001.1 Gene:Rap2c / 72065 MGIID:1919315 Length:183 Species:Mus musculus


Alignment Length:172 Identity:58/172 - (33%)
Similarity:94/172 - (54%) Gaps:16/172 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LERIRLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFP 68
            :...::|:||..|||||::..:|:..|:.:||..|:||.|.:|.::......::||||:|..||.
Mouse     1 MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFA 65

  Fly    69 AMRRLSIATAHAFMLVYAATSAPSFQCVKQCFEEI-REQRGDFQDIPIVIAGNKADLATTHREVK 132
            :||.|.|.....|:|||:..:..|||.:|...::| |.:|  ::.:|:::.|||.|| ...|||.
Mouse    66 SMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKR--YEKVPLILVGNKVDL-EPEREVM 127

  Fly   133 LEE----VTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLL 170
            ..|    ..:|        ....:|.|||..|.|.:||..::
Mouse   128 SSEGRALAQEW--------GCPFMETSAKSKSMVDELFAEIV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 58/168 (35%)
Rap2cNP_766001.1 Rap2 3..165 CDD:133376 58/170 (34%)
Effector region. /evidence=ECO:0000305 32..40 4/7 (57%)

Return to query results.
Submit another query.