DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and Rasd1

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001257883.1 Gene:Rasd1 / 64455 RGDID:619727 Length:280 Species:Rattus norvegicus


Alignment Length:252 Identity:85/252 - (33%)
Similarity:133/252 - (52%) Gaps:45/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRR 72
            |:|:||.:.|||::||.|||...:.|.|..|:||.:.:.|.:.|...::|||||||:..||||||
  Rat    26 RMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRR 90

  Fly    73 LSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQ-------DIPIVIAGNKADLATTHRE 130
            |||.|...|:||::..:..||:.|::..::|.:.:...:       |:|:||.|||.| ...:||
  Rat    91 LSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNKGD-RDFYRE 154

  Fly   131 VKLEEVTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRFLPASSS-------------- 181
            |:..|:...|..: |: |....|.|||::|::..:|::|.:::: ||:..|              
  Rat   155 VEQREIEQLVGDD-PQ-RCAYFEISAKKNSSLDQMFRALFAMAK-LPSEMSPDLHRKVSVQYCDV 216

  Fly   182 --------------GSGGSGGGGEA----APSGFKRRSSAYVSASSSRNKNRMNSPA 220
                          ||||.|..|:|    ||  |.||.|.:......|.|..::|.|
  Rat   217 LHKKALRNKKLLRAGSGGGGDHGDAFGILAP--FARRPSVHSDLMYIREKTSVSSQA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 65/170 (38%)
Ras 8..170 CDD:278499 64/168 (38%)
Rasd1NP_001257883.1 Rhes_like 25..280 CDD:133343 85/252 (34%)
Effector region 53..61 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.