DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and rasd2

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001025373.1 Gene:rasd2 / 565976 ZFINID:ZDB-GENE-050913-57 Length:335 Species:Danio rerio


Alignment Length:225 Identity:70/225 - (31%)
Similarity:113/225 - (50%) Gaps:36/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFL-FKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMR 71
            |:|:||...|||:::::||| .:.:.:.|..|.||.:::.|.:.|...::||||.|.:..|||.|
Zfish    96 RVVVLGAPRVGKTALIRRFLGEEVFEEHYEPTSEDFHSKLYHIRGERYQLDILDASKERDFPAKR 160

  Fly    72 RLSIATAHAFMLVYAATSAPSFQCVKQCFEEI----------REQRGDFQDIPIVIAGNKADLAT 126
            ||:|.|...|:||::.|...|...|....|||          :|.|    .:||:|..||||: .
Zfish   161 RLTILTGDIFLLVFSVTDRDSLTEVCSLREEIFTAKSKLTKSKENR----QLPIIICANKADV-D 220

  Fly   127 THREVKLEEVTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRFLPASSSGSGGSGGGGE 191
            :.|.|:..:|...:..:     :.:.|.|||..:|:.::|::|..|.. ||.            |
Zfish   221 SPRAVQRSDVAQCLGED-----SVLFEVSAKTCTNLEEVFEALAVLGG-LPT------------E 267

  Fly   192 AAPSGFKRRS--SAYVSASSSRNKNRMNSP 219
            ..||..:..|  :.:..:|..|||..:|.|
Zfish   268 TRPSLHRDISIHTYHALSSRKRNKRAVNEP 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 57/174 (33%)
Ras 8..170 CDD:278499 56/172 (33%)
rasd2NP_001025373.1 Rhes_like 95..335 CDD:133343 70/225 (31%)
RAS 95..258 CDD:214541 56/171 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.