DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and RASD1

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_057168.1 Gene:RASD1 / 51655 HGNCID:15828 Length:281 Species:Homo sapiens


Alignment Length:269 Identity:88/269 - (32%)
Similarity:144/269 - (53%) Gaps:39/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRR 72
            |:|:||.:.|||::||.|||...:.|.|..|:||.:.:.|.:.|...::|||||||:..||||||
Human    26 RMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRR 90

  Fly    73 LSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQ-------DIPIVIAGNKADLATTHRE 130
            |||.|...|:||::..:..||:.|::..::|.:.:...:       |:|:||.|||.| ...:||
Human    91 LSILTGDVFILVFSLDNRDSFEEVQRLRQQILDTKSCLKNKTKENVDVPLVICGNKGD-RDFYRE 154

  Fly   131 VKLEEVTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRFLPASSSGSGGSGGGGEAAPS 195
            |...|:...|..: |: |....|.|||::|::..:|::|.:::: ||:            |.:|.
Human   155 VDQREIEQLVGDD-PQ-RCAYFEISAKKNSSLDQMFRALFAMAK-LPS------------EMSPD 204

  Fly   196 GFKRRSSAY---VSASSSRNKNRMNSPALGGAGGSGGDKKG------------SSLVDAVDVATT 245
            ..::.|..|   :...:.|||..:.:.: ||.||..||..|            |.|:...:.|:.
Human   205 LHRKVSVQYCDVLHKKALRNKKLLRAGS-GGGGGDPGDAFGIVAPFARRPSVHSDLMYIREKASA 268

  Fly   246 SAEAKLKPR 254
            .::||.|.|
Human   269 GSQAKDKER 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 65/170 (38%)
Ras 8..170 CDD:278499 64/168 (38%)
RASD1NP_057168.1 Rhes_like 25..281 CDD:133343 88/269 (33%)
Effector region 53..61 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1908
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.