DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and ras-dva1

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001011503.2 Gene:ras-dva1 / 497008 XenbaseID:XB-GENE-1217929 Length:211 Species:Xenopus tropicalis


Alignment Length:224 Identity:78/224 - (34%)
Similarity:118/224 - (52%) Gaps:29/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ERIRLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPA 69
            :.:|||..|.|||||:::::|||...:.|:||.|||::|....:.|.:.|::.||||||...|||
 Frog     9 DTVRLVFFGAAGVGKTALIQRFLNDRFDDRYRRTVEEMYCLNPEPGALQLRIQILDTSGSYSFPA 73

  Fly    70 MRRLSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQDIPIVIAGNKADL---ATTHREV 131
            ||:|||....||.||::.:...|||.|::...||.:.:|| .::|||:.||:.||   ....::|
 Frog    74 MRKLSIQQGDAFALVFSLSEPDSFQEVERLRSEIIQVKGD-AEVPIVVVGNQMDLFPGLEAGQQV 137

  Fly   132 KLEEVT----DWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRFLPASSSGSGGSGGGGEA 192
            .|....    :|        ....:|.|||.|..|.|:|..|:.... .||..|           
 Frog   138 DLRAAATAELEW--------DCGYVETSAKVDYRVWDVFHQLIRRVN-SPAWLS----------- 182

  Fly   193 APSGFKRRSSAYVSASSSRNKNRMNSPAL 221
             |:..:||:||...|:.|:.:.:..|..|
 Frog   183 -PALERRRASAQPEANRSQQRRKPQSCTL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 66/170 (39%)
Ras 8..170 CDD:278499 65/168 (39%)
ras-dva1NP_001011503.2 Ras_dva 12..211 CDD:206714 78/221 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.