DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and CG8500

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster


Alignment Length:218 Identity:75/218 - (34%)
Similarity:109/218 - (50%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRR 72
            |:|:.|..||||||:|.||:..|:.:.|..|:||.|.:..........:.|.||:|..|||||:|
  Fly    20 RVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSHQFPAMQR 84

  Fly    73 LSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRG-DFQDIPIVIAGNKADLATTHREVKLEE- 135
            |||:..|||:|||:..|..|.:.::..:..|:|.:| |..:||:::.|||.|.....|||...| 
  Fly    85 LSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELREVSQAEG 149

  Fly   136 ---VTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRFLPAS----------------SS 181
               .|.|        ....:|.|||.:.|||:||:.||::.:....|                |.
  Fly   150 QAQATTW--------SISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTKKQKKQKKEKKSK 206

  Fly   182 GSGGS----GGGGEAAPSGFKRR 200
            .:.||    |..|.:|..|.|.:
  Fly   207 DTNGSIPENGDAGASASGGAKEK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 66/168 (39%)
Ras 8..170 CDD:278499 64/166 (39%)
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 66/170 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113652at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.