DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and Ras85D

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_476699.1 Gene:Ras85D / 41140 FlyBaseID:FBgn0003205 Length:189 Species:Drosophila melanogaster


Alignment Length:169 Identity:59/169 - (34%)
Similarity:93/169 - (55%) Gaps:19/169 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRR 72
            :||::|..|||||::..:.:...:.|:|..|:||.|.::..:.|.|..:|||||:|..::.|||.
  Fly     5 KLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRD 69

  Fly    73 LSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQDIPIVIAGNKADLATTHREVKLEEVT 137
            ..:.|...|:||:|..||.||:.:....|:|:..: |.:::|:|:.|||.|||:           
  Fly    70 QYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVK-DAEEVPMVLVGNKCDLAS----------- 122

  Fly   138 DW-VFCELPRLRAK-----VLECSAKEDSNVTDLFKSLL 170
             | |..|..|..||     .:|.|||....|.|.|.:|:
  Fly   123 -WNVNNEQAREVAKQYGIPYIETSAKTRMGVDDAFYTLV 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 59/169 (35%)
Ras 8..170 CDD:278499 58/167 (35%)
Ras85DNP_476699.1 H_N_K_Ras_like 3..164 CDD:133338 59/169 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.