DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and CG14669

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001262281.1 Gene:CG14669 / 40652 FlyBaseID:FBgn0037326 Length:306 Species:Drosophila melanogaster


Alignment Length:218 Identity:59/218 - (27%)
Similarity:102/218 - (46%) Gaps:19/218 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IRLVLLGGAGVGKSSIVKRFLFKTYTDKYRATV-EDLYNREYDLGGVTLKVDILDTSGDMQFPA- 69
            ::...||..||||:||:::|.:..:...::.|. ..:|...........::.:||.....:||| 
  Fly    95 LKAAFLGATGVGKTSILQQFFYHDFPRTHQTTTHRKIYKNCLVCDTCIRELMVLDVPPQKRFPAD 159

  Fly    70 -------MRRLSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQDIPIVIAGNKADLATT 127
                   ...|.:.|.||::|||...:..:||..:...::|.:. ...:|..|::.|||.| ..|
  Fly   160 NFAEWNNGHPLGLRTVHAYVLVYDMGNLETFQYCRSMRDQILDS-FSHRDFSIIVVGNKFD-NVT 222

  Fly   128 HREVKLEEVTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRFLPASSSGSGGSGGGGEA 192
            ..:...:|:.|.........|...:||||:.:..:.|:|:.|:..:     |:.|.||:||||..
  Fly   223 EAQANSQELKDISTLVRKHWRCGYVECSAQYNYKIGDVFRELMGCT-----SAVGGGGAGGGGGV 282

  Fly   193 APSGFKRRSSAYVSASSSRNKNR 215
            |..| ....:.|  :.|:|||.|
  Fly   283 AGVG-GLVGTEY--SQSTRNKGR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 43/172 (25%)
Ras 8..170 CDD:278499 42/170 (25%)
CG14669NP_001262281.1 P-loop_NTPase 95..267 CDD:304359 43/173 (25%)
small_GTPase 96..265 CDD:197466 42/170 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.