DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and rasd1

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_956826.1 Gene:rasd1 / 393504 ZFINID:ZDB-GENE-040426-1473 Length:265 Species:Danio rerio


Alignment Length:225 Identity:75/225 - (33%)
Similarity:121/225 - (53%) Gaps:27/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRR 72
            |:|:||...|||::||.|||...:.::|..|:||.:.:.|.:.|...::|||||||:..||||||
Zfish    21 RMVILGSTKVGKTAIVSRFLNGRFEEQYTPTIEDFHRKLYSIKGDVYQLDILDTSGNHPFPAMRR 85

  Fly    73 LSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQ-------DIPIVIAGNKADLATTHRE 130
            |||.|...|:||::..:..||..|::..::|.|.:...:       |:|:||.|||.| ...:||
Zfish    86 LSILTGDVFILVFSLDNRESFHEVQRLKQQIYETKSCLKNKTKENVDVPLVICGNKGD-REFYRE 149

  Fly   131 VKLEEVTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRFLPASSSGSGGSGGGGEAAPS 195
            |:.:|:...:..:   .:....|.|||.::||..:|:.|.:|:: ||            .|.:|.
Zfish   150 VQRDEIEQLIAGD---EQCAYFEISAKRNTNVDQMFQRLFTLAK-LP------------NEMSPD 198

  Fly   196 GFKRRSSAY---VSASSSRNKNRMNSPALG 222
            ..::.|..|   :...|.:||...:..|.|
Zfish   199 LHRKVSVQYCDILHKKSLKNKKVKDGDAYG 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 63/170 (37%)
Ras 8..170 CDD:278499 62/168 (37%)
rasd1NP_956826.1 small_GTPase 18..190 CDD:197466 64/172 (37%)
Rhes_like 20..265 CDD:133343 75/225 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1398885at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.