DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and CG8641

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001261494.1 Gene:CG8641 / 38771 FlyBaseID:FBgn0035733 Length:434 Species:Drosophila melanogaster


Alignment Length:280 Identity:88/280 - (31%)
Similarity:132/280 - (47%) Gaps:55/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRR 72
            |||:||.:..||||||.|||...:.:.|..|:|:.:.:.|.:.....::|||||||...||||||
  Fly   168 RLVMLGSSRAGKSSIVARFLGNRFEEAYTPTIEEFHRKLYRIRNEVFQLDILDTSGYHPFPAMRR 232

  Fly    73 LSIATAHAFMLVYAATSAPSFQCVKQCFEEIRE------------QRGDFQDIPIVIAGNKADLA 125
            ||..|...|:||::..|..||:.|.:..|.|.|            ::.....||:::||||.|  
  Fly   233 LSFLTGDLFILVFSMDSRESFEEVVRLRENILETKWAALNPGSGFKKKSLPKIPMILAGNKCD-- 295

  Fly   126 TTHREVKLEEVTDWVF----CELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRFLPASSSGSGGS 186
            ...:.|:::||..::.    |      ...:||||:::..:.|||.||.::|. ||.        
  Fly   296 RDFKTVQVDEVMGYIAGQDNC------CTFVECSARQNYRIDDLFHSLFTVSN-LPL-------- 345

  Fly   187 GGGGEAAPSGFKRRSSAYVSASSSRNKNRMNSPALGGAGGSGGDKKGSSLV-----DAVDVATTS 246
                |..|:..:|..|.:.:.|.        .|..|.|  .||.||.:..:     ||..|.|.:
  Fly   346 ----EMTPNHHRRLVSVFGAPSP--------LPPHGSA--VGGTKKNALSIKRRFSDACGVVTPN 396

  Fly   247 AEAKLKPRSRSLIRRASRKT 266
            |.   :|..|:.:.....||
  Fly   397 AR---RPSIRTDLNLMRSKT 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 64/179 (36%)
Ras 8..170 CDD:278499 63/177 (36%)
CG8641NP_001261494.1 Rhes_like 167..434 CDD:133343 88/280 (31%)
RAS 167..338 CDD:214541 63/177 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1908
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113652at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.