DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and Rap2l

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_477402.1 Gene:Rap2l / 37850 FlyBaseID:FBgn0283666 Length:182 Species:Drosophila melanogaster


Alignment Length:173 Identity:55/173 - (31%)
Similarity:92/173 - (53%) Gaps:18/173 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LERIRLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFP 68
            :...::|:||..|||||::..:|:...:.:||..|:||.|.:|.::......::||||:|..||.
  Fly     1 MREFKVVVLGSGGVGKSALTVQFVSGCFIEKYDPTIEDFYRKEIEVDSSPCVLEILDTAGTEQFA 65

  Fly    69 AMRRLSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQDIPIVIAGNKADLATTHREVK- 132
            :||.|.|...|.|:::|:.|:..:||.:......|...:|. |..||::..||.|| ...|||. 
  Fly    66 SMRDLYIKNGHGFIVMYSLTNHQTFQDISSMKNVITRVKGS-QPAPILLVANKFDL-DCQREVST 128

  Fly   133 -----LEEVTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLL 170
                 |.::.|..|          :|.|||:..||.::|.:::
  Fly   129 AEGNALAQLWDCPF----------IEASAKDRINVNEVFATIV 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 55/169 (33%)
Ras 8..170 CDD:278499 55/167 (33%)
Rap2lNP_477402.1 Rap2 16..165 CDD:133376 49/158 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.