DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and Rala

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_525063.1 Gene:Rala / 31332 FlyBaseID:FBgn0015286 Length:201 Species:Drosophila melanogaster


Alignment Length:184 Identity:58/184 - (31%)
Similarity:96/184 - (52%) Gaps:18/184 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRR 72
            :::::|..|||||::..:|::..:.:.|..|..|.|.::..|.|..:::|||||:|...:.|:|.
  Fly    13 KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRD 77

  Fly    73 LSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQDIPIVIAGNKADLATTHREVKLEEVT 137
            ....:...|:.|::.|...|||..::..|:|...:.| :.||.::.|||.|| ...|:|.|.|  
  Fly    78 NYFRSGEGFLCVFSITDDESFQATQEFREQILRVKND-ESIPFLLVGNKCDL-NDKRKVPLSE-- 138

  Fly   138 DWVFCELPRLRAK-----VLECSAKEDSNVTDLFKSLLS--LSRFLPASSSGSG 184
                |:   |||:     .:|.|||...||..:|..|:.  .||....|.:.||
  Fly   139 ----CQ---LRAQQWAVPYVETSAKTRENVDKVFFDLMREIRSRKTEDSKATSG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 53/170 (31%)
Ras 8..170 CDD:278499 52/166 (31%)
RalaNP_525063.1 RalA_RalB 12..174 CDD:206710 53/171 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.