DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and Diras2

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001163049.1 Gene:Diras2 / 291006 RGDID:1305580 Length:199 Species:Rattus norvegicus


Alignment Length:171 Identity:69/171 - (40%)
Similarity:100/171 - (58%) Gaps:13/171 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRR 72
            |:.:.|..||||||:|.||:..|:.:.|..||||.|.:..........:.|.||:|..|||||:|
  Rat     9 RVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQR 73

  Fly    73 LSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQDIPIVIAGNKADLATTHREVKLEE-- 135
            |||:..|||:|||:.||..|.:.:|..:|:|.|.:||.:.|||::.|||.| .:.:|||:..|  
  Rat    74 LSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCD-ESPNREVQSSEAE 137

  Fly   136 --VTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSR 174
              ...|        :...:|.|||.:.||.:||:.||:|.:
  Rat   138 ALARTW--------KCAFMETSAKLNHNVKELFQELLNLEK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 68/167 (41%)
Ras 8..170 CDD:278499 66/165 (40%)
Diras2NP_001163049.1 ARHI_like 7..170 CDD:206711 69/169 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.