DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and rhb1

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_595194.1 Gene:rhb1 / 2540853 PomBaseID:SPBC428.16c Length:185 Species:Schizosaccharomyces pombe


Alignment Length:189 Identity:53/189 - (28%)
Similarity:93/189 - (49%) Gaps:15/189 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADLERIRLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDM 65
            ||.::..|:.:||...|||||:..:::...:.:.|..|:|:.:::.....|.....:|:||:|..
pombe     1 MAPIKSRRIAVLGSRSVGKSSLTVQYVENHFVESYYPTIENTFSKNIKYKGQEFATEIIDTAGQD 65

  Fly    66 QFPAMRRLSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQDIPIVIAGNKADLATTHRE 130
            ::..:........|.::|||:.||..||:.||...::|....|. :.:|||:.|||:|| ...|.
pombe    66 EYSILNSKHSIGIHGYVLVYSITSKSSFEMVKIVRDKILNHTGT-EWVPIVVVGNKSDL-HMQRA 128

  Fly   131 VKLEE----VTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLS-LSRFLPASSSGSG 184
            |..||    ..:|        :....|.||:.:.||...|:.::| :.:....|..|.|
pombe   129 VTAEEGKALANEW--------KCAWTEASARHNENVARAFELIISEIEKQANPSPPGDG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 48/168 (29%)
Ras 8..170 CDD:278499 47/165 (28%)
rhb1NP_595194.1 small_GTPase 5..170 CDD:197466 48/174 (28%)
RheB 6..184 CDD:206709 51/184 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.