DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and Rras

DIOPT Version :10

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_033127.1 Gene:Rras / 20130 MGIID:98179 Length:218 Species:Mus musculus


Alignment Length:156 Identity:37/156 - (23%)
Similarity:49/156 - (31%) Gaps:30/156 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 IRMLLPY-QPDYKQEQLKVPGTGVCANGTCNGQHSHQPYHPWPEEPSSVISERCTRARINSAIFV 206
            ||:|.|. .|:      ||...|:.....|..|::     |.|:||.......|:....|..|.:
Mouse   101 IRLLSPVTNPE------KVVCVGMNYKDHCLEQNA-----PIPKEPIIFSKFPCSITGPNDDIIL 154

  Fly   207 SSEGKGFD-SIEFIRRYGSQSVLCRKAKSAENVSASERQRRFSEYPEWETEDSTTGNGTSAHSAS 270
            ..|.:..| .:|.      ..|:.||.|..:...|......|           |..|..||....
Mouse   155 PDESQEVDWEVEL------AFVIGRKGKHIKEEEALSYIAGF-----------TVANDVSARDWQ 202

  Fly   271 NARRKKSLRQDSIEMVECHKEPAAVT 296
            ..|..|...........|...||.||
Mouse   203 MKRNGKQWLLGKTFDTFCPLGPALVT 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 8/29 (28%)
RrasNP_033127.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
M_R_Ras_like 28..191 CDD:133345 26/117 (22%)
Effector region 58..66
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.