DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and D1081.4

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_492298.3 Gene:D1081.4 / 183928 WormBaseID:WBGene00008382 Length:221 Species:Caenorhabditis elegans


Alignment Length:268 Identity:65/268 - (24%)
Similarity:106/268 - (39%) Gaps:78/268 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RIRLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDL-GGVTLKVDILDTSGDMQFPA 69
            ::.:.:||...||||::|.:||:..:.:.||.|||:....||:: .|..|.|.|:|:||...|..
 Worm    22 KVTVAVLGAERVGKSAMVSQFLWHKFVEDYRPTVEEFNWIEYEIEEGRVLMVQIIDSSGSRDFIG 86

  Fly    70 MRRLSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQDIPIVIAGNKADLATTHREVKLE 134
            |:.|.|.||.||::|:||..|.|.:.......:|..:||:  .:|:::..||.|..         
 Worm    87 MKNLYIGTADAFLVVFAADDASSLEEALSTLSDIHARRGN--SVPVLLVANKTDKP--------- 140

  Fly   135 EVTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRFLPASSSGSGGSGGGGEAAPS---- 195
                   |.........:||.|..:..|...|..:|..:|                   |:    
 Worm   141 -------CLSCCASKSNMECCALREEEVRACFHEILLRTR-------------------PNLNIQ 179

  Fly   196 GFKRRSSAYVSASSSRNKNRMNSPALGGAGGSGGDKKGSSLVDAVDVATTSAEAKLKPRSRSLIR 260
            ||:.|            |.|.:.|:..|..|                        ::|:....|:
 Worm   180 GFELR------------KRRQSMPSSRGYSG------------------------VEPKDIEKIK 208

  Fly   261 RASRKTKQ 268
            .|.|:.|:
 Worm   209 SARRQQKE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 50/164 (30%)
Ras 8..170 CDD:278499 49/162 (30%)
D1081.4NP_492298.3 P-loop_NTPase 24..>138 CDD:304359 42/115 (37%)
RHO 27..167 CDD:197554 49/157 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24070
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.