DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and drn-1

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_001333544.2 Gene:drn-1 / 183765 WormBaseID:WBGene00016911 Length:219 Species:Caenorhabditis elegans


Alignment Length:235 Identity:72/235 - (30%)
Similarity:112/235 - (47%) Gaps:52/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTL-KVDILDTSGDMQFPAMR 71
            |:.:.|..|||||||.:||:..|:.:.|..|:||.|.:........: .:.|.||:|..|||||:
 Worm    32 RVAVFGAGGVGKSSITQRFVKGTFNENYVPTIEDTYRQVISCNQKNVCTLQITDTTGSHQFPAMQ 96

  Fly    72 RLSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGD-FQDIPIVIAGNKADLATTHREVKL-- 133
            ||||:..:||:|:|:.|:..||..:....|.::|.:|: ..:.||::.|||.| ..:.|||..  
 Worm    97 RLSISKGNAFILIYSVTNKQSFAELVPIIEMMKEVKGNAIAETPIMLVGNKKD-EESKREVSSNS 160

  Fly   134 -EEVTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRFLPASSSGSGGSGGGGEAAPSGF 197
             ::|...:.|..       :|.|||.:.|:|:||:.||:|.                        
 Worm   161 GQKVATNMECGF-------IETSAKNNENITELFQQLLALE------------------------ 194

  Fly   198 KRRSSAYVSASSSRNKNRMNSPALGGAGGSGGDKKGSSLV 237
            |:|..|..          |:.|     .|..|.|||..::
 Worm   195 KKRQLALT----------MDDP-----DGKNGKKKGCHIM 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 61/168 (36%)
Ras 8..170 CDD:278499 59/166 (36%)
drn-1NP_001333544.2 P-loop_NTPase 30..195 CDD:328724 62/194 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.