DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and RHEBL1

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:NP_653194.1 Gene:RHEBL1 / 121268 HGNCID:21166 Length:183 Species:Homo sapiens


Alignment Length:167 Identity:49/167 - (29%)
Similarity:90/167 - (53%) Gaps:14/167 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRR 72
            ::|:||...|||:|:..:|:...:::.|..|||:.|::...||.....:.::||:|..::..:..
Human     8 KVVILGYRCVGKTSLAHQFVEGEFSEGYDPTVENTYSKIVTLGKDEFHLHLVDTAGQDEYSILPY 72

  Fly    73 LSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQDIPIVIAGNKADLATTHREVKLEE-- 135
            ..|...|.::|||:.||..|||.::..::::.|..|..: :|:|:.|||||| :..|||:..|  
Human    73 SFIIGVHGYVLVYSVTSLHSFQVIESLYQKLHEGHGKTR-VPVVLVGNKADL-SPEREVQAVEGK 135

  Fly   136 --VTDWVFCELPRLRAKVLECSAKEDSNVTDLFKSLL 170
              ...|        .|..:|.||:|:.....:|..::
Human   136 KLAESW--------GATFMESSARENQLTQGIFTKVI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 49/167 (29%)
Ras 8..170 CDD:278499 49/165 (30%)
RHEBL1NP_653194.1 small_GTPase 5..169 CDD:197466 49/167 (29%)
RheB 6..183 CDD:206709 49/167 (29%)
Effector region 35..43 4/7 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.