DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30158 and si:dkey-27j5.5

DIOPT Version :9

Sequence 1:NP_652315.2 Gene:CG30158 / 50149 FlyBaseID:FBgn0050158 Length:280 Species:Drosophila melanogaster
Sequence 2:XP_001345197.3 Gene:si:dkey-27j5.5 / 100006464 ZFINID:ZDB-GENE-121214-264 Length:387 Species:Danio rerio


Alignment Length:296 Identity:83/296 - (28%)
Similarity:126/296 - (42%) Gaps:73/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLVLLGGAGVGKSSIVKRFLFKTYTDKYRATVEDLYNREYDLGGVTLKVDILDTSGDMQFPAMRR 72
            |:|:||...|||:||::|||...:.::|..|.||.:.:.|.:.|.|.::||||.||:..|||.||
Zfish   142 RIVVLGAPRVGKTSILRRFLRDGFEEQYEPTCEDFHRKLYQIRGETYQIDILDASGERSFPAKRR 206

  Fly    73 LSIATAHAFMLVYAATSAPSFQCVKQCFEEIREQRGDFQD------IPIVIAGNKADLATTHREV 131
            |||.|...|:||::.....||:.|:....||...:...:.      :|.|:..||.||....|.|
Zfish   207 LSILTGDIFLLVFSLDDRSSFEEVRALHTEIVAAKAALRRSKQPLCVPTVVCANKVDLPAEQRAV 271

  Fly   132 KLEEVTDWV--FCELPRLRAKVLECSAKEDSNVTDLFKSLLSLSRFLPASSSGSGGSGGGG---E 191
            ...||...:  .|.|       .|.|||:..|:..:|::|                :..||   |
Zfish   272 SRPEVLSALGSSCAL-------FETSAKDSVNLEQVFEAL----------------AQRGGLPLE 313

  Fly   192 AAPSGFKRRS-SAYVSASSSRNKNR-MNSPALGGAGGSGGDKKGSSLVDAVDVATTSAEAKLKPR 254
            ..||..::.| .:|.:..::|...: ..:||.....|:                       |.| 
Zfish   314 TGPSQHRKVSIRSYQALRAARQAEKGSKAPACEAPCGA-----------------------LYP- 354

  Fly   255 SRSLIRRAS----------RKTKQQINNASDDCNVQ 280
               |.||.|          .|..::.:.|.|.|.:|
Zfish   355 ---LARRPSFGTDLRLVLGPKGNRKQSKALDKCQIQ 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30158NP_652315.2 Ras 8..172 CDD:206642 61/171 (36%)
Ras 8..170 CDD:278499 60/169 (36%)
si:dkey-27j5.5XP_001345197.3 small_GTPase 139..304 CDD:197466 60/168 (36%)
P-loop_NTPase 141..387 CDD:304359 82/294 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.