DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)2b and Eny2

DIOPT Version :9

Sequence 1:NP_001287204.1 Gene:e(y)2b / 50143 FlyBaseID:FBgn0040670 Length:95 Species:Drosophila melanogaster
Sequence 2:XP_038935818.1 Gene:Eny2 / 685258 RGDID:1596439 Length:105 Species:Rattus norvegicus


Alignment Length:81 Identity:31/81 - (38%)
Similarity:52/81 - (64%) Gaps:6/81 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LRSQDKAALKELLHTRLVECGWHKDIKEMIRNIIMERGVDNINRDQLAAQIVPQARALVPEVVKN 83
            :.:.::..|||||..:|:||||...:|...:.:|.|:|::::..|.|.|:|.|:.|||||:.||.
  Rat    25 IETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKK 89

  Fly    84 EMMLRV------HAAL 93
            |::.|:      ||:|
  Rat    90 ELLQRIRTFLAQHASL 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)2bNP_001287204.1 EnY2 19..93 CDD:287172 30/79 (38%)
Eny2XP_038935818.1 EnY2 20..98 CDD:401971 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538551at2759
OrthoFinder 1 1.000 - - FOG0004955
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103619
Panther 1 1.100 - - O PTHR12514
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.