powered by:
Protein Alignment e(y)2b and eny2
DIOPT Version :9
Sequence 1: | NP_001287204.1 |
Gene: | e(y)2b / 50143 |
FlyBaseID: | FBgn0040670 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002427.1 |
Gene: | eny2 / 436700 |
ZFINID: | ZDB-GENE-040718-124 |
Length: | 95 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 29/71 - (40%) |
Similarity: | 48/71 - (67%) |
Gaps: | 0/71 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 DKAALKELLHTRLVECGWHKDIKEMIRNIIMERGVDNINRDQLAAQIVPQARALVPEVVKNEMML 87
::..|||||..:|:||||...:|.:.:.:|.|:|::|:..:.|.|.:.|:.|||||:.||.|::.
Zfish 20 ERERLKELLRAKLIECGWRDQLKALCKEVIKEKGIENVTVEDLVAGVTPKGRALVPDSVKKELLQ 84
Fly 88 RVHAAL 93
|:.|.|
Zfish 85 RIRAFL 90
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
e(y)2b | NP_001287204.1 |
EnY2 |
19..93 |
CDD:287172 |
28/69 (41%) |
eny2 | NP_001002427.1 |
EnY2 |
11..89 |
CDD:401971 |
27/68 (40%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1538551at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004955 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_103619 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12514 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.880 |
|
Return to query results.
Submit another query.