DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)2b and Eny2

DIOPT Version :9

Sequence 1:NP_001287204.1 Gene:e(y)2b / 50143 FlyBaseID:FBgn0040670 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_778174.1 Gene:Eny2 / 223527 MGIID:1919286 Length:101 Species:Mus musculus


Alignment Length:81 Identity:31/81 - (38%)
Similarity:52/81 - (64%) Gaps:6/81 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LRSQDKAALKELLHTRLVECGWHKDIKEMIRNIIMERGVDNINRDQLAAQIVPQARALVPEVVKN 83
            :.:.::..|||||..:|:||||...:|...:.:|.|:|::::..|.|.|:|.|:.|||||:.||.
Mouse    21 IETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKK 85

  Fly    84 EMMLRV------HAAL 93
            |::.|:      ||:|
Mouse    86 ELLQRIRTFLAQHASL 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)2bNP_001287204.1 EnY2 19..93 CDD:287172 30/79 (38%)
Eny2NP_778174.1 EnY2 16..94 CDD:401971 28/72 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4479
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004955
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103619
Panther 1 1.100 - - O PTHR12514
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.770

Return to query results.
Submit another query.