DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)2b and SUS1

DIOPT Version :9

Sequence 1:NP_001287204.1 Gene:e(y)2b / 50143 FlyBaseID:FBgn0040670 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_878049.2 Gene:SUS1 / 1466445 SGDID:S000028510 Length:96 Species:Saccharomyces cerevisiae


Alignment Length:90 Identity:20/90 - (22%)
Similarity:42/90 - (46%) Gaps:15/90 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQDKAALKELLHTRLVECGWHKDIKEMIRNIIMERG-VD----------NINRD----QLAAQIV 70
            :.|.|.||..:...|||.|.::.|...::..:::.| ||          |||..    |:.:.:.
Yeast     2 TMDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINESTNFTQILSTVE 66

  Fly    71 PQARALVPEVVKNEMMLRVHAALDK 95
            |:|..:|.:..:..::.::...|::
Yeast    67 PKALEMVSDSTRETVLKQIREFLEE 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)2bNP_001287204.1 EnY2 19..93 CDD:287172 19/86 (22%)
SUS1NP_878049.2 EnY2 12..88 CDD:401971 15/75 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I3064
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I1851
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004955
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103619
Panther 1 1.100 - - O PTHR12514
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
66.010

Return to query results.
Submit another query.