DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment e(y)2b and eny2

DIOPT Version :9

Sequence 1:NP_001287204.1 Gene:e(y)2b / 50143 FlyBaseID:FBgn0040670 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001123672.1 Gene:eny2 / 100170422 XenbaseID:XB-GENE-961810 Length:96 Species:Xenopus tropicalis


Alignment Length:75 Identity:31/75 - (41%)
Similarity:51/75 - (68%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LRSQDKAALKELLHTRLVECGWHKDIKEMIRNIIMERGVDNINRDQLAAQIVPQARALVPEVVKN 83
            :.:.::..|||||..:|:||||...:|...:::|.|:||:::..|.|.|:|.|:.|||||:.||.
 Frog    16 IETGERERLKELLRAKLIECGWRDQLKAHCKDVINEKGVEHVTVDDLVAEITPKGRALVPDSVKK 80

  Fly    84 EMMLRVHAAL 93
            |::.|:.|.|
 Frog    81 ELLQRIRAFL 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
e(y)2bNP_001287204.1 EnY2 19..93 CDD:287172 30/73 (41%)
eny2NP_001123672.1 EnY2 9..90 CDD:370844 30/73 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538551at2759
OrthoFinder 1 1.000 - - FOG0004955
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12514
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.