DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13551 and STF1

DIOPT Version :9

Sequence 1:NP_652302.1 Gene:CG13551 / 50133 FlyBaseID:FBgn0040660 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_010152.1 Gene:STF1 / 851426 SGDID:S000007232 Length:86 Species:Saccharomyces cerevisiae


Alignment Length:102 Identity:28/102 - (27%)
Similarity:45/102 - (44%) Gaps:32/102 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RSASRLYPAGVQLAKMSGSQVGDLGSGAGKGGGGGGSIREAGGAFGKLEAAREEEYFYKKQREQL 70
            |.|||.|                  |....||.|.|:.::   .|.|.|.|:|:.|..:::||||
Yeast    17 RIASRFY------------------SDGPLGGAGPGNPQD---IFIKRERAKEDYYARQQEREQL 60

  Fly    71 DRLKNDQIHQAEFHHQQIKEHEEAIQRHKEFLENLHK 107
            ..:|           :|:|||::.::..:..:.||.|
Yeast    61 AHVK-----------EQLKEHKKKLENLENKINNLSK 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13551NP_652302.1 IATP 3..97 CDD:367997 25/90 (28%)
STF1NP_010152.1 IATP <24..86 CDD:367997 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.