DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13551 and CG34423

DIOPT Version :9

Sequence 1:NP_652302.1 Gene:CG13551 / 50133 FlyBaseID:FBgn0040660 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001163263.1 Gene:CG34423 / 5740313 FlyBaseID:FBgn0085452 Length:85 Species:Drosophila melanogaster


Alignment Length:74 Identity:51/74 - (68%)
Similarity:61/74 - (82%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFVVRRSASRLYPAGVQLAKMSGSQVGDLGSGAGKGGGGGGSIREAGGAFGKLEAAREEEYFYKK 65
            ||.:||.:.|.||..:|..||  ||:|:||||||.|||||||||||||:|||:|||||||:|||:
  Fly     1 MFTLRRFSQRWYPKQIQHLKM--SQIGELGSGAGNGGGGGGSIREAGGSFGKMEAAREEEFFYKQ 63

  Fly    66 QREQLDRLK 74
            |:|||..||
  Fly    64 QKEQLKNLK 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13551NP_652302.1 IATP 3..97 CDD:367997 49/72 (68%)
CG34423NP_001163263.1 IATP <41..74 CDD:282433 25/32 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10808
eggNOG 1 0.900 - - E1_COG0212
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I5026
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26075
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006685
OrthoInspector 1 1.000 - - otm43592
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2415
SonicParanoid 1 1.000 - - X3633
1010.000

Return to query results.
Submit another query.