DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13551 and Mthfs

DIOPT Version :10

Sequence 1:NP_652302.1 Gene:CG13551 / 50133 FlyBaseID:FBgn0040660 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001097432.1 Gene:Mthfs / 37699 FlyBaseID:FBgn0085453 Length:201 Species:Drosophila melanogaster


Alignment Length:90 Identity:19/90 - (21%)
Similarity:32/90 - (35%) Gaps:15/90 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GVQLAKMSGSQVGDLGSGAGKGGGGGGSIREAGGAFGKLEAAREEEYFYKKQREQLDRLKNDQIH 79
            |:.|..:.|......|:..|.|          .|.:.|......|:|.:||.......| |:|| 
  Fly   127 GIDLFIVPGVAFTRCGARMGHG----------MGYYDKFLKQHAEKYPHKKISLMALSL-NEQI- 179

  Fly    80 QAEFHHQQIKEHEEAIQRHKEFLEN 104
               ..::::......::.|....||
  Fly   180 ---VSNEELPMESHDVRLHSVITEN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13551NP_652302.1 IATP 3..97 CDD:428014 16/81 (20%)
MthfsNP_001097432.1 FAU1 10..201 CDD:439982 17/88 (19%)

Return to query results.
Submit another query.