DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13551 and Atp5if1

DIOPT Version :9

Sequence 1:NP_652302.1 Gene:CG13551 / 50133 FlyBaseID:FBgn0040660 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_037047.2 Gene:Atp5if1 / 25392 RGDID:2181 Length:107 Species:Rattus norvegicus


Alignment Length:100 Identity:39/100 - (39%)
Similarity:59/100 - (59%) Gaps:9/100 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SRLYPAGVQLAKMSGSQVGDLGSGAGKG-GGGGGSIREAGGAFGKLEAAREEEYFYKKQREQLDR 72
            :||...|:::.:..|     .||.:.:. ..|.||||||||||||.|.|.|:.||.:|.||||..
  Rat    10 ARLGVWGMRVLQTRG-----FGSDSSESMDSGAGSIREAGGAFGKREKAEEDRYFREKTREQLAA 69

  Fly    73 LKNDQIHQAEFHHQQIKEHEEAIQRHK---EFLEN 104
            ||.....:.:.|.::|:..::.|:|||   ::|:|
  Rat    70 LKKHHEDEIDHHSKEIERLQKQIERHKKKIKYLKN 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13551NP_652302.1 IATP 3..97 CDD:367997 34/88 (39%)
Atp5if1NP_037047.2 IATP 18..87 CDD:367997 30/73 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..58 18/32 (56%)
N-terminal inhibitory region. /evidence=ECO:0000250 26..52 15/25 (60%)
Antiparallel alpha-helical coiled coil region. /evidence=ECO:0000250 74..106 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349458
Domainoid 1 1.000 60 1.000 Domainoid score I10326
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5258
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006685
OrthoInspector 1 1.000 - - otm45665
orthoMCL 1 0.900 - - OOG6_107203
Panther 1 1.100 - - LDO PTHR23407
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3633
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.