DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13551 and mai-2

DIOPT Version :9

Sequence 1:NP_652302.1 Gene:CG13551 / 50133 FlyBaseID:FBgn0040660 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_500336.1 Gene:mai-2 / 177106 WormBaseID:WBGene00015248 Length:109 Species:Caenorhabditis elegans


Alignment Length:105 Identity:48/105 - (45%)
Similarity:72/105 - (68%) Gaps:6/105 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFVVRRSASRLYPAGVQLAKMSGSQVGDLGSGAGKGGGGGGSIREAGGAFGKLEAAREEEYFYKK 65
            |..|.|:|:|:  .|: :|:.|   .|..|.|||:|||.|||||:|||||||:|||||:||||||
 Worm     1 MLSVSRAATRM--TGM-VARFS---AGGHGDGAGRGGGSGGSIRDAGGAFGKMEAAREDEYFYKK 59

  Fly    66 QREQLDRLKNDQIHQAEFHHQQIKEHEEAIQRHKEFLENL 105
            |:.||..|:.....:.:.|..|::.|::.::||::.:..:
 Worm    60 QKAQLQELREHIQEEVKHHEGQLENHKKVLERHQQRISEI 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13551NP_652302.1 IATP 3..97 CDD:367997 45/93 (48%)
mai-2NP_500336.1 IATP <36..85 CDD:282433 27/48 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163474
Domainoid 1 1.000 89 1.000 Domainoid score I4993
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I3625
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006685
OrthoInspector 1 1.000 - - otm14581
orthoMCL 1 0.900 - - OOG6_107203
Panther 1 1.100 - - LDO PTHR23407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2415
SonicParanoid 1 1.000 - - X3633
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.920

Return to query results.
Submit another query.