DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13551 and atp5if1

DIOPT Version :9

Sequence 1:NP_652302.1 Gene:CG13551 / 50133 FlyBaseID:FBgn0040660 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001135565.1 Gene:atp5if1 / 100216112 XenbaseID:XB-GENE-956790 Length:109 Species:Xenopus tropicalis


Alignment Length:106 Identity:51/106 - (48%)
Similarity:73/106 - (68%) Gaps:9/106 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ASRLYPAGVQ---LAKM--SGSQVGDLGSGAGKGGGGGGSIREAGGAFGKLEAAREEEYFYKKQR 67
            :|.|..||::   |.:|  |..|:|:||.|||||||||||:|||||||||.:||.||.||.:|::
 Frog     4 SSSLLRAGIRNVLLMQMRRSSDQLGELGKGAGKGGGGGGSVREAGGAFGKRQAAEEERYFRQKEQ 68

  Fly    68 EQLDRLKNDQIHQAEFHHQ--QIKEHEEAIQRHKEFLENLH 106
            ||:..|:..  |:.|.||.  :|:..::.|:|||..::.|:
 Frog    69 EQIASLRKH--HEEEIHHHKGEIERLQKEIERHKSKIKKLN 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13551NP_652302.1 IATP 3..97 CDD:367997 47/95 (49%)
atp5if1NP_001135565.1 IATP 18..99 CDD:282433 42/82 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..109 43/83 (52%)
N-terminal inhibitory region. /evidence=ECO:0000250 27..56 23/28 (82%)
Antiparallel alpha-helical coiled coil region. /evidence=ECO:0000250 78..109 10/30 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I7994
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I4937
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48754
Panther 1 1.100 - - LDO PTHR23407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2415
SonicParanoid 1 1.000 - - X3633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.