DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13551 and Mthfsl

DIOPT Version :9

Sequence 1:NP_652302.1 Gene:CG13551 / 50133 FlyBaseID:FBgn0040660 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001122073.1 Gene:Mthfsl / 100039707 MGIID:3780550 Length:203 Species:Mus musculus


Alignment Length:59 Identity:15/59 - (25%)
Similarity:25/59 - (42%) Gaps:2/59 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GGGSIREAGGAFGKLEAAREEEYFYKKQREQLDRLKN--DQIHQAEFHHQQIKEHEEAI 95
            |.|.:||...:.|.|:........:.|...:|.|.|.  |...:....||::|.:..|:
Mouse   115 GEGDVREEALSTGGLDLIFLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQEVKPYTMAL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13551NP_652302.1 IATP 3..97 CDD:367997 15/59 (25%)
MthfslNP_001122073.1 5-FTHF_cyc-lig 10..198 CDD:280059 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0212
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.