DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13551 and atp5if1a

DIOPT Version :9

Sequence 1:NP_652302.1 Gene:CG13551 / 50133 FlyBaseID:FBgn0040660 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001082990.1 Gene:atp5if1a / 100037369 ZFINID:ZDB-GENE-070410-36 Length:105 Species:Danio rerio


Alignment Length:86 Identity:45/86 - (52%)
Similarity:61/86 - (70%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KMSGSQVGDLGSGAGKGGGGGGSIREAGGAFGKLEAAREEEYFYKKQREQLDRLKNDQIHQAEFH 84
            :||..|:|:||:|||||||||||:|.|||:||:.|||.||.||.:|:||||..|||....:.:.|
Zfish    16 RMSSDQLGELGTGAGKGGGGGGSVRAAGGSFGRREAAEEERYFRQKEREQLAALKNHHEEEIDHH 80

  Fly    85 HQQIKEHEEAIQRHKEFLENL 105
            .::|:..:..|.|||..:..|
Zfish    81 KKEIERLQREIDRHKGKIRKL 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13551NP_652302.1 IATP 3..97 CDD:367997 41/76 (54%)
atp5if1aNP_001082990.1 IATP 2..80 CDD:282433 38/63 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..52 24/34 (71%)
N-terminal inhibitory region. /evidence=ECO:0000250 22..51 20/28 (71%)
Antiparallel alpha-helical coiled coil region. /evidence=ECO:0000250 73..105 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590717
Domainoid 1 1.000 92 1.000 Domainoid score I7603
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I5026
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26533
orthoMCL 1 0.900 - - OOG6_107203
Panther 1 1.100 - - LDO PTHR23407
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2415
SonicParanoid 1 1.000 - - X3633
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.