DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OTX1 and PHDP

DIOPT Version :10

Sequence 1:NP_055377.1 Gene:OTX1 / 5013 HGNCID:8521 Length:354 Species:Homo sapiens
Sequence 2:NP_523834.1 Gene:PHDP / 37788 FlyBaseID:FBgn0025334 Length:220 Species:Drosophila melanogaster


Alignment Length:125 Identity:53/125 - (42%)
Similarity:73/125 - (58%) Gaps:23/125 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     4 YLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMR 68
            :||.  ||.:||.|...:               ||||.|||||.:||:.||.:|.:|.||||:.|
  Fly    95 HLKS--YGDDGLSLTDKS---------------KQRRIRTTFTSNQLNELEKIFLETHYPDIYTR 142

Human    69 EEVALKINLPESRVQVWFKNRRAKCRQQQQSG---SGTKSRPAKKKSSPVRESSGSESSG 125
            ||:|.|::|.|:||||||:|||||.|:|::..   ...||.....:.:||   :||:..|
  Fly   143 EEIASKLHLTEARVQVWFQNRRAKFRKQERHAIYIMKDKSSKLDGRKNPV---AGSKYLG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OTX1NP_055377.1 Homeodomain 39..95 CDD:459649 35/55 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..146 11/38 (29%)
TF_Otx 178..274 CDD:427350
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..305
PHDPNP_523834.1 Homeodomain 113..169 CDD:459649 35/55 (64%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.