DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OTX1 and otp

DIOPT Version :9

Sequence 1:NP_001186699.1 Gene:OTX1 / 5013 HGNCID:8521 Length:354 Species:Homo sapiens
Sequence 2:NP_001286654.1 Gene:otp / 37364 FlyBaseID:FBgn0015524 Length:416 Species:Drosophila melanogaster


Alignment Length:275 Identity:85/275 - (30%)
Similarity:121/275 - (44%) Gaps:50/275 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    37 KQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGS 101
            ||:|.||.||.:||:.||..|:||.|||||||||:|::|.|.||||||||:|||||.::      
  Fly   115 KQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKK------ 173

Human   102 GTKSRPAKKKSSPVRESSGSESSGQFTPPAVSSSASSSSSASSSSANPAAAAAAGLGGNPVAAA- 165
                   :||::.|..:.|:.......||..::..:.:.................:|.||:.|. 
  Fly   174 -------RKKTTNVFRTPGALLPSHGLPPFGANITNIAMGDGLCGTGMFGGDRWSVGVNPMTAGF 231

Human   166 --SSLSTPAASSIWS--PASISPGSAPASVSVPE-PLAAPSNTSCMQRSVAAGAATAAASYPMSY 225
              .:.|:|.:||:.|  .:.|:.|||..:.|... .|.|..::...|.||..          :|.
  Fly   232 GQLNQSSPLSSSLNSGLNSGINMGSALGAGSYQHYGLNALGDSMMYQHSVGG----------VSC 286

Human   226 GQGGSYGQGYPTPSSSYFGGVDCSSYLAPMHSHHHPHQLSPMA--PSSMAGHHHHHPHAHHPLSQ 288
            |..||.....|...:|      |||...|           |::  |:|.....:..|...|...|
  Fly   287 GPSGSPSATTPPNMNS------CSSVTPP-----------PLSAQPNSSQNELNGEPMPLHQQQQ 334

Human   289 SSGHHHHHH--HHHH 301
            ...|.|...  |.||
  Fly   335 QQTHQHQQQQTHQHH 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OTX1NP_001186699.1 Homeobox 42..95 CDD:395001 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..146 8/54 (15%)
TF_Otx 180..274 CDD:397546 23/96 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..305 11/49 (22%)
otpNP_001286654.1 Homeobox 119..167 CDD:278475 31/47 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I5000
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.