DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OTX1 and OdsH

DIOPT Version :10

Sequence 1:NP_055377.1 Gene:OTX1 / 5013 HGNCID:8521 Length:354 Species:Homo sapiens
Sequence 2:NP_523389.3 Gene:OdsH / 32758 FlyBaseID:FBgn0026058 Length:382 Species:Drosophila melanogaster


Alignment Length:72 Identity:38/72 - (52%)
Similarity:49/72 - (68%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    37 KQRRERTTFTRSQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGS 101
            |:||.||.|...||..||.:|..:.||||||||.:|.|::|.|.|:.|||:|||||.|:|:.:..
  Fly   157 KKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEGRIAVWFQNRRAKWRKQEHTKK 221

Human   102 GTKSRPA 108
            | ..|||
  Fly   222 G-PGRPA 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OTX1NP_055377.1 Homeodomain 39..95 CDD:459649 31/55 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..146 8/18 (44%)
TF_Otx 178..274 CDD:427350
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..305
OdsHNP_523389.3 Homeodomain 159..215 CDD:459649 31/55 (56%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.