powered by:
Protein Alignment CG15458 and ATP5MK
DIOPT Version :9
Sequence 1: | NP_652293.1 |
Gene: | CG15458 / 50124 |
FlyBaseID: | FBgn0040651 |
Length: | 63 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001193355.1 |
Gene: | ATP5MK / 84833 |
HGNCID: | 30889 |
Length: | 58 |
Species: | Homo sapiens |
Alignment Length: | 34 |
Identity: | 13/34 - (38%) |
Similarity: | 20/34 - (58%) |
Gaps: | 0/34 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 FNSQTMRGRANVAKATWASLGLVYVLVKMHRRNT 44
|||.|:.||.|...||:.|:.|:.:..|:..:.|
Human 19 FNSYTLTGRMNCVLATYGSIALIVLYFKLRSKKT 52
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006119 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_108639 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR34038 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.000 |
|
Return to query results.
Submit another query.