DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15458 and atp5md

DIOPT Version :9

Sequence 1:NP_652293.1 Gene:CG15458 / 50124 FlyBaseID:FBgn0040651 Length:63 Species:Drosophila melanogaster
Sequence 2:NP_001186962.1 Gene:atp5md / 794625 ZFINID:ZDB-GENE-110914-234 Length:58 Species:Danio rerio


Alignment Length:35 Identity:13/35 - (37%)
Similarity:20/35 - (57%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FNSQTMRGRANVAKATWASLGLVYVLVKMHRRNTK 45
            |||.|:.||.|...||:||:..:.:..|:..:..|
Zfish    19 FNSYTITGRRNCVLATYASIAAIILFFKLKPKKQK 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15458NP_652293.1 ATP_synth_reg <11..38 CDD:291621 11/26 (42%)
atp5mdNP_001186962.1 ATP_synth_reg 1..51 CDD:291621 12/31 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006119
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108639
Panther 1 1.100 - - O PTHR34038
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.