DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15456 and MIEN1

DIOPT Version :9

Sequence 1:NP_001285491.1 Gene:CG15456 / 50123 FlyBaseID:FBgn0040650 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001317135.1 Gene:MIEN1 / 84299 HGNCID:28230 Length:116 Species:Homo sapiens


Alignment Length:67 Identity:26/67 - (38%)
Similarity:34/67 - (50%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKVEVEYCGICNFSGQCHLLREFLLASSPDLDISCRTGRRGSFEVSIDGQLVHSKLSCLAFPQHA 66
            |::.||||..|.|......|...:....|.::|..|.|..|:||:.|:||||.|||....||...
Human    23 VRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEK 87

  Fly    67 SV 68
            .|
Human    88 DV 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15456NP_001285491.1 CXXU_selWTH 4..74 CDD:274013 25/65 (38%)
MIEN1NP_001317135.1 CXXU_selWTH 25..89 CDD:274013 24/63 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143587
Domainoid 1 1.000 48 1.000 Domainoid score I11970
eggNOG 1 0.900 - - E1_2CYC3
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5395
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1615913at2759
OrthoFinder 1 1.000 - - FOG0006228
OrthoInspector 1 1.000 - - oto90617
orthoMCL 1 0.900 - - OOG6_107930
Panther 1 1.100 - - LDO PTHR15124
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5601
SonicParanoid 1 1.000 - - X4502
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.