powered by:
Protein Alignment CG15456 and SELENOW
DIOPT Version :9
Sequence 1: | NP_001285491.1 |
Gene: | CG15456 / 50123 |
FlyBaseID: | FBgn0040650 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_003000.1 |
Gene: | SELENOW / 6415 |
HGNCID: | 10752 |
Length: | 87 |
Species: | Homo sapiens |
Alignment Length: | 57 |
Identity: | 22/57 - (38%) |
Similarity: | 29/57 - (50%) |
Gaps: | 5/57 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 VEVEYCGICNFSGQCHLLREFLLASSPD-LDISCRTG---RRGSFEVSIDGQLVHSK 56
|.|.|||...:..:...|::.|....|. ||| |..| ..|.|||.:.|:|:|||
Human 5 VRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDI-CGEGTPQATGFFEVMVAGKLIHSK 60
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.