DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15456 and SELENOW

DIOPT Version :9

Sequence 1:NP_001285491.1 Gene:CG15456 / 50123 FlyBaseID:FBgn0040650 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_003000.1 Gene:SELENOW / 6415 HGNCID:10752 Length:87 Species:Homo sapiens


Alignment Length:57 Identity:22/57 - (38%)
Similarity:29/57 - (50%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEVEYCGICNFSGQCHLLREFLLASSPD-LDISCRTG---RRGSFEVSIDGQLVHSK 56
            |.|.|||...:..:...|::.|....|. ||| |..|   ..|.|||.:.|:|:|||
Human     5 VRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDI-CGEGTPQATGFFEVMVAGKLIHSK 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15456NP_001285491.1 CXXU_selWTH 4..74 CDD:274013 22/57 (39%)
SELENOWNP_003000.1 CXXU_selWTH 5..78 CDD:274013 22/57 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.